Lineage for d2h62d_ (2h62 D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032362Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 3032363Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 3032364Domain d2h62d_: 2h62 D: [136180]
    Other proteins in same PDB: d2h62a_, d2h62b_, d2h62c_
    automated match to d1nysa_

Details for d2h62d_

PDB Entry: 2h62 (more details), 1.85 Å

PDB Description: Crystal structure of a ternary ligand-receptor complex of BMP-2
PDB Compounds: (D:) Acvr2b protein

SCOPe Domain Sequences for d2h62d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h62d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
aetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfn
cydrqecvateenpqvyfcccegnfcnerfthl

SCOPe Domain Coordinates for d2h62d_:

Click to download the PDB-style file with coordinates for d2h62d_.
(The format of our PDB-style files is described here.)

Timeline for d2h62d_: