SCOPe 2.05: Domain d2h62c_: 2h62 C:

Lineage for d2h62c_ (2h62 C:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein automated matches [254536] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255202] (1 PDB entry)

8. Domain d2h62c_: 2h62 C: [136179]
   Other proteins in same PDB: d2h62a_, d2h62b_, d2h62d_
   automated match to d3qb4d_

Details for d2h62c_

PDB Entry: 2h62, 1.85 Å

PDB Description: Crystal structure of a ternary ligand-receptor complex of BMP-2

PDB Compounds: (C:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2h62c_:

Sequence; same for both SEQRES and ATOM records:

>d2h62c_ g.7.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlpp

Timeline for d2h62c_:

• d2h62c_ first appeared in SCOP 1.73, called d2h62c1
  
• d2h62c_ appears in SCOPe 2.04
  
• d2h62c_ appears in SCOPe 2.06
  
• d2h62c_ appears in the current release, SCOPe 2.08