Class g: Small proteins [56992] (91 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein automated matches [254536] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255202] (1 PDB entry) |
Domain d2h62c_: 2h62 C: [136179] Other proteins in same PDB: d2h62a_, d2h62b_, d2h62d_ automated match to d3qb4d_ |
PDB Entry: 2h62 (more details), 1.85 Å
SCOPe Domain Sequences for d2h62c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h62c_ g.7.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka qlrrtieccrtnlcnqylqptlpp
Timeline for d2h62c_: