SCOPe 2.01: Domain d2h62c1: 2h62 C:34-117

Lineage for d2h62c1 (2h62 C:34-117)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)

8. Domain d2h62c1: 2h62 C:34-117 [136179]
   Other proteins in same PDB: d2h62a_, d2h62b_
   automatically matched to d1es7d_

Details for d2h62c1

PDB Entry: 2h62, 1.85 Å

PDB Description: Crystal structure of a ternary ligand-receptor complex of BMP-2

PDB Compounds: (C:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2h62c1:

Sequence; same for both SEQRES and ATOM records:

>d2h62c1 g.7.1.3 (C:34-117) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlpp

Timeline for d2h62c1:

• d2h62c1 first appeared in SCOP 1.73
  
• d2h62c1 appears in SCOP 1.75
  
• d2h62c1 appears in SCOPe 2.02
  
• d2h62c1 appears in the current release, SCOPe 2.08, called d2h62c_