Class g: Small proteins [56992] (90 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
Protein BMP receptor Ia ectodomain [57359] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries) |
Domain d2h62c1: 2h62 C:34-117 [136179] Other proteins in same PDB: d2h62a_, d2h62b_ automatically matched to d1es7d_ |
PDB Entry: 2h62 (more details), 1.85 Å
SCOPe Domain Sequences for d2h62c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h62c1 g.7.1.3 (C:34-117) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka qlrrtieccrtnlcnqylqptlpp
Timeline for d2h62c1: