![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
![]() | Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57517] (13 PDB entries) |
![]() | Domain d2h62b_: 2h62 B: [136178] Other proteins in same PDB: d2h62c_, d2h62d_ automated match to d3bmpa_ |
PDB Entry: 2h62 (more details), 1.85 Å
SCOPe Domain Sequences for d2h62b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h62b_ g.17.1.2 (B:) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]} ssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnhaivqtlvnsvn skipkaccvptelsaismlyldenekvvlknyqdmvvegcgcr
Timeline for d2h62b_: