![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein automated matches [190132] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries) |
![]() | Domain d2h61f_: 2h61 F: [136174] automated match to d1mq1a_ complexed with ca, pg4 |
PDB Entry: 2h61 (more details), 1.9 Å
SCOPe Domain Sequences for d2h61f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h61f_ a.39.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet ldndgdgecdfqefmafvamvttacheffeh
Timeline for d2h61f_: