Lineage for d2h61d1 (2h61 D:1-90)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640684Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 640685Protein Calcyclin (S100) [47479] (17 species)
  7. 640769Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (3 PDB entries)
  8. 640773Domain d2h61d1: 2h61 D:1-90 [136172]
    automatically matched to d1mq1a_
    complexed with ca, pg4

Details for d2h61d1

PDB Entry: 2h61 (more details), 1.9 Å

PDB Description: X-ray structure of human Ca2+-loaded S100B
PDB Compounds: (D:) Protein S100-B

SCOP Domain Sequences for d2h61d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h61d1 a.39.1.2 (D:1-90) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffeh

SCOP Domain Coordinates for d2h61d1:

Click to download the PDB-style file with coordinates for d2h61d1.
(The format of our PDB-style files is described here.)

Timeline for d2h61d1: