Lineage for d2h5ma_ (2h5m A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921456Protein Hypothetical protein SA2309 [103173] (1 species)
  7. 1921457Species Staphylococcus aureus [TaxId:1280] [103174] (2 PDB entries)
  8. 1921459Domain d2h5ma_: 2h5m A: [136167]
    automated match to d1r57a_
    complexed with aco

Details for d2h5ma_

PDB Entry: 2h5m (more details)

PDB Description: NMR Solution Structure of a GCN5-like putative N-acetyltransferase from Staphylococcus aureus complexed with acetyl-CoA. Northeast Structural Genomics Consortium Target ZR31
PDB Compounds: (A:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2h5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5ma_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}
msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
veharennlkiiascsfakhmlekedsyqdvylglehhhhhh

SCOPe Domain Coordinates for d2h5ma_:

Click to download the PDB-style file with coordinates for d2h5ma_.
(The format of our PDB-style files is described here.)

Timeline for d2h5ma_: