SCOPe 2.08: Domain d2h5ma2: 2h5m A:1-94

Lineage for d2h5ma2 (2h5m A:1-94)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein SA2309 [103173] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [103174] (2 PDB entries)

8. Domain d2h5ma2: 2h5m A:1-94 [136167]
   Other proteins in same PDB: d2h5ma3
   automated match to d1r57a_
   complexed with aco
   missing some secondary structures that made up less than one-third of the common domain

Details for d2h5ma2

PDB Entry: 2h5m

PDB Description: NMR Solution Structure of a GCN5-like putative N-acetyltransferase from Staphylococcus aureus complexed with acetyl-CoA. Northeast Structural Genomics Consortium Target ZR31

PDB Compounds: (A:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2h5ma2:

Sequence; same for both SEQRES and ATOM records:

>d2h5ma2 d.108.1.1 (A:1-94) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}
msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
veharennlkiiascsfakhmlekedsyqdvylg

Timeline for d2h5ma2:

• d2h5ma2 first appeared in SCOP 1.73, called d2h5ma1
  
• d2h5ma2 appears in SCOPe 2.07