Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein S-adenosylhomocystein hydrolase [51845] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries) |
Domain d2h5lf1: 2h5l F:190-352 [136161] Other proteins in same PDB: d2h5la2, d2h5lb2, d2h5lc2, d2h5ld2, d2h5le2, d2h5lf2, d2h5lg2, d2h5lh2 automated match to d1k0ua1 complexed with 3dd, nad |
PDB Entry: 2h5l (more details), 2.8 Å
SCOPe Domain Sequences for d2h5lf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5lf1 c.2.1.4 (F:190-352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]} nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh
Timeline for d2h5lf1: