Lineage for d2h5le1 (2h5l E:190-352)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844156Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2844257Protein S-adenosylhomocystein hydrolase [51845] (3 species)
  7. 2844264Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries)
  8. 2844285Domain d2h5le1: 2h5l E:190-352 [136159]
    Other proteins in same PDB: d2h5la2, d2h5lb2, d2h5lc2, d2h5ld2, d2h5le2, d2h5lf2, d2h5lg2, d2h5lh2
    automated match to d1k0ua1
    complexed with 3dd, nad

Details for d2h5le1

PDB Entry: 2h5l (more details), 2.8 Å

PDB Description: s-adenosylhomocysteine hydrolase containing nad and 3-deaza-d- eritadenine
PDB Compounds: (E:) Adenosylhomocysteinase

SCOPe Domain Sequences for d2h5le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5le1 c.2.1.4 (E:190-352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

SCOPe Domain Coordinates for d2h5le1:

Click to download the PDB-style file with coordinates for d2h5le1.
(The format of our PDB-style files is described here.)

Timeline for d2h5le1: