Lineage for d2h5ka1 (2h5k A:57-152)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572000Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2572001Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)
  8. 2572066Domain d2h5ka1: 2h5k A:57-152 [136149]
    automatically matched to d1fhs__
    complexed with cac

Details for d2h5ka1

PDB Entry: 2h5k (more details), 3.25 Å

PDB Description: crystal structure of complex between the domain-swapped dimeric grb2 sh2 domain and shc-derived ligand, ac-nh-ptyr-val-asn-nh2
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d2h5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5ka1 d.93.1.1 (A:57-152) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOPe Domain Coordinates for d2h5ka1:

Click to download the PDB-style file with coordinates for d2h5ka1.
(The format of our PDB-style files is described here.)

Timeline for d2h5ka1: