SCOP 1.73: Domain d2h5ka1: 2h5k A:57-152

Lineage for d2h5ka1 (2h5k A:57-152)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (32 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries)

8. Domain d2h5ka1: 2h5k A:57-152 [136149]
   automatically matched to d1fhs__
   complexed with ace, cac, nh2

Details for d2h5ka1

PDB Entry: 2h5k, 3.25 Å

PDB Description: crystal structure of complex between the domain-swapped dimeric grb2 sh2 domain and shc-derived ligand, ac-nh-ptyr-val-asn-nh2

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOP Domain Sequences for d2h5ka1:

Sequence; same for both SEQRES and ATOM records:

>d2h5ka1 d.93.1.1 (A:57-152) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

Timeline for d2h5ka1:

• d2h5ka1 is new in SCOP 1.73
  
• d2h5ka1 appears in SCOP 1.75
  
• d2h5ka1 appears in the current release, SCOPe 2.08