SCOP 1.73: Domain d2h5fb1: 2h5f B:4-77

Lineage for d2h5fb1 (2h5f B:4-77)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.1: Snake venom toxins [57303] (27 proteins)

6. Protein Denmotoxin [144107] (1 species)

7. Species Mangrove snake (Boiga dendrophila) [TaxId:46286] [144108] (1 PDB entry)

8. Domain d2h5fb1: 2h5f B:4-77 [136148]
   automatically matched to 2H5F A:3-77
   complexed with k, na, po4

Details for d2h5fb1

PDB Entry: 2h5f, 1.9 Å

PDB Description: Denmotoxin: A the three-finger toxin from colubrid snake Boiga dendrophila with bird-specific activity

PDB Compounds: (B:) denmotoxin

SCOP Domain Sequences for d2h5fb1:

Sequence; same for both SEQRES and ATOM records:

>d2h5fb1 g.7.1.1 (B:4-77) Denmotoxin {Mangrove snake (Boiga dendrophila) [TaxId: 46286]}
glphgfciqcnrktwsncsighrclpyhmtcytlykpdengemkwavkgcarmcptaksg
ervkcctgascnsd

Timeline for d2h5fb1:

• d2h5fb1 is new in SCOP 1.73
  
• d2h5fb1 appears in SCOP 1.75
  
• d2h5fb1 appears in the current release, SCOPe 2.08, called d2h5fb_