![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein automated matches [190676] (9 species) not a true protein |
![]() | Species Mangrove snake (Boiga dendrophila) [TaxId:46286] [187789] (1 PDB entry) |
![]() | Domain d2h5fb_: 2h5f B: [136148] Other proteins in same PDB: d2h5fa1 automated match to d2h5fa1 complexed with k, na, po4 |
PDB Entry: 2h5f (more details), 1.9 Å
SCOPe Domain Sequences for d2h5fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5fb_ g.7.1.1 (B:) automated matches {Mangrove snake (Boiga dendrophila) [TaxId: 46286]} glphgfciqcnrktwsncsighrclpyhmtcytlykpdengemkwavkgcarmcptaksg ervkcctgascnsd
Timeline for d2h5fb_: