SCOPe 2.08: Domain d2h5fa1: 2h5f A:3-77

Lineage for d2h5fa1 (2h5f A:3-77)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Denmotoxin [144107] (1 species)

7. Species Mangrove snake (Boiga dendrophila) [TaxId:46286] [144108] (1 PDB entry)
   Uniprot Q06ZW0 33-111

8. Domain d2h5fa1: 2h5f A:3-77 [136147]
   Other proteins in same PDB: d2h5fb_
   complexed with k, na, po4

Details for d2h5fa1

PDB Entry: 2h5f, 1.9 Å

PDB Description: Denmotoxin: A the three-finger toxin from colubrid snake Boiga dendrophila with bird-specific activity

PDB Compounds: (A:) denmotoxin

SCOPe Domain Sequences for d2h5fa1:

Sequence; same for both SEQRES and ATOM records:

>d2h5fa1 g.7.1.1 (A:3-77) Denmotoxin {Mangrove snake (Boiga dendrophila) [TaxId: 46286]}
vglphgfciqcnrktwsncsighrclpyhmtcytlykpdengemkwavkgcarmcptaks
gervkcctgascnsd

Timeline for d2h5fa1:

• d2h5fa1 first appeared in SCOP 1.73
  
• d2h5fa1 appears in SCOPe 2.07