Lineage for d2h5fa1 (2h5f A:3-77)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032254Protein Denmotoxin [144107] (1 species)
  7. 3032255Species Mangrove snake (Boiga dendrophila) [TaxId:46286] [144108] (1 PDB entry)
    Uniprot Q06ZW0 33-111
  8. 3032256Domain d2h5fa1: 2h5f A:3-77 [136147]
    Other proteins in same PDB: d2h5fb_
    complexed with k, na, po4

Details for d2h5fa1

PDB Entry: 2h5f (more details), 1.9 Å

PDB Description: Denmotoxin: A the three-finger toxin from colubrid snake Boiga dendrophila with bird-specific activity
PDB Compounds: (A:) denmotoxin

SCOPe Domain Sequences for d2h5fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5fa1 g.7.1.1 (A:3-77) Denmotoxin {Mangrove snake (Boiga dendrophila) [TaxId: 46286]}
vglphgfciqcnrktwsncsighrclpyhmtcytlykpdengemkwavkgcarmcptaks
gervkcctgascnsd

SCOPe Domain Coordinates for d2h5fa1:

Click to download the PDB-style file with coordinates for d2h5fa1.
(The format of our PDB-style files is described here.)

Timeline for d2h5fa1: