![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein alpha-Lytic protease [50498] (1 species) |
![]() | Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries) |
![]() | Domain d2h5ca_: 2h5c A: [136145] automated match to d1boqa_ complexed with gol, so4 |
PDB Entry: 2h5c (more details), 0.82 Å
SCOPe Domain Sequences for d2h5ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5ca_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt anyaegavrgltqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl ferlqpilsqyglslvtg
Timeline for d2h5ca_: