Lineage for d2h5ax4 (2h5a X:368-463)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872694Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 872695Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 872719Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 872720Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)
  8. 872724Domain d2h5ax4: 2h5a X:368-463 [136144]
    Other proteins in same PDB: d2h5ax1, d2h5ax2, d2h5ax3
    automatically matched to d1k2yx4
    complexed with x1p, zn

Details for d2h5ax4

PDB Entry: 2h5a (more details), 1.72 Å

PDB Description: complex of the enzyme pmm/pgm with xylose 1-phosphate
PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOP Domain Sequences for d2h5ax4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5ax4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOP Domain Coordinates for d2h5ax4:

Click to download the PDB-style file with coordinates for d2h5ax4.
(The format of our PDB-style files is described here.)

Timeline for d2h5ax4: