![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins) |
![]() | Domain d2h5ax3: 2h5a X:259-367 [136143] Other proteins in same PDB: d2h5ax1, d2h5ax4 automated match to d1p5dx3 complexed with x1p, zn |
PDB Entry: 2h5a (more details), 1.72 Å
SCOPe Domain Sequences for d2h5ax3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5ax3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase, middle and C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf
Timeline for d2h5ax3: