SCOPe 2.08: Domain d2h5ax1: 2h5a X:9-154

Lineage for d2h5ax1 (2h5a X:9-154)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)

6. Protein Phosphomannomutase/phosphoglucomutase, N-terminal domain [419008] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [419480] (12 PDB entries)

8. Domain d2h5ax1: 2h5a X:9-154 [136141]
   Other proteins in same PDB: d2h5ax2, d2h5ax3, d2h5ax4
   automated match to d1k2yx1
   complexed with x1p, zn
   has additional insertions and/or extensions that are not grouped together

Details for d2h5ax1

PDB Entry: 2h5a, 1.72 Å

PDB Description: complex of the enzyme pmm/pgm with xylose 1-phosphate

PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d2h5ax1:

Sequence; same for both SEQRES and ATOM records:

>d2h5ax1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

Timeline for d2h5ax1:

• d2h5ax1 first appeared in SCOP 1.73
  
• d2h5ax1 appears in SCOPe 2.07