Lineage for d2h4ub_ (2h4u B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550920Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2550963Protein Hypothetical protein Them2 [143179] (2 species)
  7. 2550964Species Human (Homo sapiens) [TaxId:9606] [143181] (2 PDB entries)
    Uniprot Q9NPJ3 19-139! Uniprot Q9NPJ3 3-138
  8. 2550966Domain d2h4ub_: 2h4u B: [136083]
    Other proteins in same PDB: d2h4ud3
    automated match to d2h4ua1

Details for d2h4ub_

PDB Entry: 2h4u (more details), 2.2 Å

PDB Description: Crystal Structure of Human Thioesterase Superfamily Member 2 (CASP Target)
PDB Compounds: (B:) Thioesterase superfamily member 2

SCOPe Domain Sequences for d2h4ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4ub_ d.38.1.5 (B:) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]}
rnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatlvdnistmallcterg
apgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnkatgkliaqgrhtkhl
g

SCOPe Domain Coordinates for d2h4ub_:

Click to download the PDB-style file with coordinates for d2h4ub_.
(The format of our PDB-style files is described here.)

Timeline for d2h4ub_: