Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries) |
Domain d2h4lx2: 2h4l X:155-258 [136079] Other proteins in same PDB: d2h4lx4 automated match to d1p5dx2 complexed with r1p, zn |
PDB Entry: 2h4l (more details), 2.4 Å
SCOPe Domain Sequences for d2h4lx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h4lx2 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} ilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevdgnfpnhh pdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtii
Timeline for d2h4lx2: