SCOPe 2.07: Domain d2h4lx1: 2h4l X:9-154

Lineage for d2h4lx1 (2h4l X:9-154)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)

6. Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)

8. Domain d2h4lx1: 2h4l X:9-154 [136078]
   Other proteins in same PDB: d2h4lx4
   automated match to d1k2yx1
   complexed with r1p, zn

Details for d2h4lx1

PDB Entry: 2h4l, 2.4 Å

PDB Description: complex of pmm/pgm with ribose 1-phosphate

PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d2h4lx1:

Sequence; same for both SEQRES and ATOM records:

>d2h4lx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

Timeline for d2h4lx1:

• d2h4lx1 first appeared in SCOP 1.73
  
• d2h4lx1 appears in SCOPe 2.06
  
• d2h4lx1 appears in the current release, SCOPe 2.08