Lineage for d2h4lx1 (2h4l X:9-154)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709628Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 709629Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 709630Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 709683Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 709684Species Pseudomonas aeruginosa [TaxId:287] [69608] (10 PDB entries)
  8. 709709Domain d2h4lx1: 2h4l X:9-154 [136078]
    Other proteins in same PDB: d2h4lx4
    automatically matched to d1k2yx1
    complexed with r1p, zn

Details for d2h4lx1

PDB Entry: 2h4l (more details), 2.4 Å

PDB Description: complex of pmm/pgm with ribose 1-phosphate
PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOP Domain Sequences for d2h4lx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4lx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

SCOP Domain Coordinates for d2h4lx1:

Click to download the PDB-style file with coordinates for d2h4lx1.
(The format of our PDB-style files is described here.)

Timeline for d2h4lx1: