Lineage for d2h4ja1 (2h4j A:1-245)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694413Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (7 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 694449Protein NAD-dependent deacetylase NpdA [142126] (1 species)
  7. 694450Species Thermotoga maritima [TaxId:2336] [142127] (8 PDB entries)
  8. 694458Domain d2h4ja1: 2h4j A:1-245 [136076]
    automatically matched to 1YC5 A:1-245
    complexed with nca, oad, zn

Details for d2h4ja1

PDB Entry: 2h4j (more details), 2.1 Å

PDB Description: Sir2-deacetylated peptide (from enzymatic turnover in crystal)
PDB Compounds: (A:) NAD-dependent deacetylase

SCOP Domain Sequences for d2h4ja1:

Sequence, based on SEQRES records: (download)

>d2h4ja1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]}
mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
eeggi

Sequence, based on observed residues (ATOM records): (download)

>d2h4ja1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]}
mkmkefldllnesrltvtltgagistpsgipdfsqnvfdidffyshpeefyrfakegifp
mlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekk
ytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgss
lvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggi

SCOP Domain Coordinates for d2h4ja1:

Click to download the PDB-style file with coordinates for d2h4ja1.
(The format of our PDB-style files is described here.)

Timeline for d2h4ja1: