Lineage for d2h3za_ (2h3z A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329914Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2329915Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2329916Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2329917Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
    topologically similar to one subunit in the interferon-gamma intertwined dimer
  7. 2329918Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (12 PDB entries)
  8. 2329939Domain d2h3za_: 2h3z A: [136062]
    automated match to d2hmxa_
    complexed with pbu

Details for d2h3za_

PDB Entry: 2h3z (more details)

PDB Description: Structure of the HIV-1 matrix protein bound to di-C4-phosphatidylinositol-(4,5)-bisphosphate
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2h3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3za_ a.61.1.1 (A:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
tgnnsqvsqny

SCOPe Domain Coordinates for d2h3za_:

Click to download the PDB-style file with coordinates for d2h3za_.
(The format of our PDB-style files is described here.)

Timeline for d2h3za_: