SCOP 1.73: Domain d2h3wb1: 2h3w B:30-405

Lineage for d2h3wb1 (2h3w B:30-405)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Carnitine acetyltransferase [82425] (2 species)
   relative spatial position of the domains is similar to the monomers in CAT trimer

7. Species Mouse (Mus musculus) [TaxId:10090] [82426] (9 PDB entries)

8. Domain d2h3wb1: 2h3w B:30-405 [136060]
   automatically matched to d1ndba1
   complexed with coa, hc5; mutant

Details for d2h3wb1

PDB Entry: 2h3w, 2.1 Å

PDB Description: crystal structure of the s554a/m564g mutant of murine carnitine acetyltransferase in complex with hexanoylcarnitine and coa

PDB Compounds: (B:) carnitine acetyltransferase

SCOP Domain Sequences for d2h3wb1:

Sequence; same for both SEQRES and ATOM records:

>d2h3wb1 c.43.1.3 (B:30-405) Carnitine acetyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
kndiekakqnlsimiq

Timeline for d2h3wb1:

• d2h3wb1 is new in SCOP 1.73
  
• d2h3wb1 appears in SCOP 1.75
  
• d2h3wb1 appears in the current release, SCOPe 2.08