SCOPe 2.04: Domain d2h3va_: 2h3v A:

Lineage for d2h3va_ (2h3v A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein automated matches [228657] (4 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [255199] (3 PDB entries)

8. Domain d2h3va_: 2h3v A: [136057]
   automated match to d1upha_
   complexed with pio

Details for d2h3va_

PDB Entry: 2h3v

PDB Description: structure of the hiv-1 matrix protein bound to di-c8- phosphatidylinositol-(4,5)-bisphosphate

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2h3va_:

Sequence; same for both SEQRES and ATOM records:

>d2h3va_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
tgnnsqvsqny

Timeline for d2h3va_:

• d2h3va_ first appeared in SCOP 1.73, called d2h3va1
  
• d2h3va_ was called d2h3va1 in SCOPe 2.03
  
• d2h3va_ appears in SCOPe 2.05
  
• d2h3va_ appears in the current release, SCOPe 2.08