SCOPe 2.05: Domain d2h3ua2: 2h3u A:406-625

Lineage for d2h3ua2 (2h3u A:406-625)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Carnitine acetyltransferase [82425] (2 species)
   relative spatial position of the domains is similar to the monomers in CAT trimer

7. Species Mouse (Mus musculus) [TaxId:10090] [82426] (9 PDB entries)
   Uniprot P47934

8. Domain d2h3ua2: 2h3u A:406-625 [136054]
   automated match to d1ndba2
   complexed with 152, coa

Details for d2h3ua2

PDB Entry: 2h3u, 1.9 Å

PDB Description: crystal structure of murine carnitine acetyltransferase in complex with carnitine and coa

PDB Compounds: (A:) carnitine acetyltransferase

SCOPe Domain Sequences for d2h3ua2:

Sequence; same for both SEQRES and ATOM records:

>d2h3ua2 c.43.1.3 (A:406-625) Carnitine acetyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
dldimmltfhhfgkdfpkseklspdafiqvalqlayyriygqacatyesaslrmfhlgrt
dtirsasidslafvkgmgdstvpeqqkvellrkavqahraytdrairgeafdrhllglkl
qaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvmffgpvvpdgygicynpmeahi
nfsvsaynscaetnaarmahylekalldmrtllqnhprak

Timeline for d2h3ua2:

• d2h3ua2 first appeared in SCOP 1.73
  
• d2h3ua2 appears in SCOPe 2.04
  
• d2h3ua2 appears in SCOPe 2.06
  
• d2h3ua2 appears in the current release, SCOPe 2.08