Lineage for d2h3pb1 (2h3p B:30-405)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482501Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2482502Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2482604Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 2482605Protein Carnitine acetyltransferase [82425] (2 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 2482611Species Mouse (Mus musculus) [TaxId:10090] [82426] (9 PDB entries)
    Uniprot P47934
  8. 2482642Domain d2h3pb1: 2h3p B:30-405 [136050]
    Other proteins in same PDB: d2h3pa3, d2h3pb3
    automated match to d1t7qa1
    complexed with 152, aco, coa

Details for d2h3pb1

PDB Entry: 2h3p (more details), 2.2 Å

PDB Description: crystal structure of murine carnitine acetyltransferase in complex with carnitine and acetyl-coa
PDB Compounds: (B:) carnitine acetyltransferase

SCOPe Domain Sequences for d2h3pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3pb1 c.43.1.3 (B:30-405) Carnitine acetyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
kndiekakqnlsimiq

SCOPe Domain Coordinates for d2h3pb1:

Click to download the PDB-style file with coordinates for d2h3pb1.
(The format of our PDB-style files is described here.)

Timeline for d2h3pb1: