SCOPe 2.08: Domain d2h3ed2: 2h3e D:101-153

Lineage for d2h3ed2 (2h3e D:101-153)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
   Uniprot P00478

8. Domain d2h3ed2: 2h3e D:101-153 [136043]
   Other proteins in same PDB: d2h3ea1, d2h3ea2, d2h3eb1, d2h3ec1, d2h3ec2, d2h3ed1
   automated match to d1d09b2
   complexed with 6pr, zn

Details for d2h3ed2

PDB Entry: 2h3e, 2.3 Å

PDB Description: structure of wild-type e. coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2h3ed2:

Sequence; same for both SEQRES and ATOM records:

>d2h3ed2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d2h3ed2:

• d2h3ed2 first appeared in SCOP 1.73
  
• d2h3ed2 appears in SCOPe 2.07