Lineage for d2h3ed2 (2h3e D:101-153)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036845Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 3036846Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 3036847Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 3036848Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
    Uniprot P00478
  8. 3036920Domain d2h3ed2: 2h3e D:101-153 [136043]
    Other proteins in same PDB: d2h3ea1, d2h3ea2, d2h3eb1, d2h3ec1, d2h3ec2, d2h3ed1
    automated match to d1d09b2
    complexed with 6pr, zn

Details for d2h3ed2

PDB Entry: 2h3e (more details), 2.3 Å

PDB Description: structure of wild-type e. coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2h3ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3ed2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d2h3ed2:

Click to download the PDB-style file with coordinates for d2h3ed2.
(The format of our PDB-style files is described here.)

Timeline for d2h3ed2: