Lineage for d2h3ed1 (2h3e D:9-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949509Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2949510Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2949511Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2949512Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. 2949584Domain d2h3ed1: 2h3e D:9-100 [136042]
    Other proteins in same PDB: d2h3ea1, d2h3ea2, d2h3eb2, d2h3ec1, d2h3ec2, d2h3ed2
    automated match to d1d09b1
    complexed with 6pr, zn

Details for d2h3ed1

PDB Entry: 2h3e (more details), 2.3 Å

PDB Description: structure of wild-type e. coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2h3ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3ed1 d.58.2.1 (D:9-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
veaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflse
dqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d2h3ed1:

Click to download the PDB-style file with coordinates for d2h3ed1.
(The format of our PDB-style files is described here.)

Timeline for d2h3ed1: