![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) ![]() automatically mapped to Pfam PF01948 |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
![]() | Domain d2h3eb1: 2h3e B:9-100 [136038] Other proteins in same PDB: d2h3ea1, d2h3ea2, d2h3eb2, d2h3ec1, d2h3ec2, d2h3ed2 automated match to d1d09b1 complexed with 6pr, zn |
PDB Entry: 2h3e (more details), 2.3 Å
SCOPe Domain Sequences for d2h3eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3eb1 d.58.2.1 (B:9-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} veaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflse dqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d2h3eb1: