SCOPe 2.07: Domain d2h39a2: 2h39 A:196-350

Lineage for d2h39a2 (2h39 A:196-350)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
   duplication: consists of 2 HIT-like motifs
   binds zinc and iron ions

6. Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries)
   Uniprot Q9FK51

8. Domain d2h39a2: 2h39 A:196-350 [136033]
   automatically matched to d1vkva2
   complexed with adq, cl, zn

Details for d2h39a2

PDB Entry: 2h39, 2.23 Å

PDB Description: crystal structure of an adp-glucose phosphorylase from arabidopsis thaliana with bound adp-glucose

PDB Compounds: (A:) Probable galactose-1-phosphate uridyl transferase

SCOPe Domain Sequences for d2h39a2:

Sequence; same for both SEQRES and ATOM records:

>d2h39a2 d.13.1.2 (A:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh
sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi
vpqlsgvggfeigtgcyinpvfpedvakvmrevsl

Timeline for d2h39a2:

• d2h39a2 first appeared in SCOP 1.73
  
• d2h39a2 appears in SCOPe 2.06
  
• d2h39a2 appears in the current release, SCOPe 2.08