Lineage for d2h39a2 (2h39 A:196-350)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716552Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 716553Superfamily d.13.1: HIT-like [54197] (3 families) (S)
  5. 716602Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 716603Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species)
  7. 716629Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries)
  8. 716639Domain d2h39a2: 2h39 A:196-350 [136033]
    automatically matched to d1vkva2
    complexed with adq, cl, zn; mutant

Details for d2h39a2

PDB Entry: 2h39 (more details), 2.23 Å

PDB Description: crystal structure of an adp-glucose phosphorylase from arabidopsis thaliana with bound adp-glucose
PDB Compounds: (A:) Probable galactose-1-phosphate uridyl transferase

SCOP Domain Sequences for d2h39a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h39a2 d.13.1.2 (A:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh
sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi
vpqlsgvggfeigtgcyinpvfpedvakvmrevsl

SCOP Domain Coordinates for d2h39a2:

Click to download the PDB-style file with coordinates for d2h39a2.
(The format of our PDB-style files is described here.)

Timeline for d2h39a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h39a1