Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein) duplication: consists of 2 HIT-like motifs binds zinc and iron ions |
Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries) Uniprot Q9FK51 |
Domain d2h39a2: 2h39 A:196-350 [136033] automatically matched to d1vkva2 complexed with adq, cl, zn |
PDB Entry: 2h39 (more details), 2.23 Å
SCOPe Domain Sequences for d2h39a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h39a2 d.13.1.2 (A:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi vpqlsgvggfeigtgcyinpvfpedvakvmrevsl
Timeline for d2h39a2: