SCOPe 2.08: Domain d2h2sd1: 2h2s D:1-106

Lineage for d2h2sd1 (2h2s D:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2h2sd1: 2h2s D:1-106 [136024]
   Other proteins in same PDB: d2h2sa_, d2h2sb_, d2h2sc_, d2h2sd2, d2h2se_, d2h2sf2
   automated match to d1ikfl1
   complexed with sek; mutant

Details for d2h2sd1

PDB Entry: 2h2s, 3.1 Å

PDB Description: crystal structure of e148a mutant of clc-ec1 in secn-

PDB Compounds: (D:) Fab fragment, light chain

SCOPe Domain Sequences for d2h2sd1:

Sequence; same for both SEQRES and ATOM records:

>d2h2sd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d2h2sd1:

• d2h2sd1 first appeared in SCOP 1.73
  
• d2h2sd1 appears in SCOPe 2.07