Lineage for d2h2sb_ (2h2s B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024422Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 3024423Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 3024424Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 3024425Protein Clc chloride channel [69913] (2 species)
  7. 3024426Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 3024454Domain d2h2sb_: 2h2s B: [136023]
    Other proteins in same PDB: d2h2sc_, d2h2sd1, d2h2sd2, d2h2se_, d2h2sf1, d2h2sf2
    automated match to d1kpla_
    complexed with sek; mutant

Details for d2h2sb_

PDB Entry: 2h2s (more details), 3.1 Å

PDB Description: crystal structure of e148a mutant of clc-ec1 in secn-
PDB Compounds: (B:) CLC Cl transporter

SCOPe Domain Sequences for d2h2sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2sb_ f.20.1.1 (B:) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d2h2sb_:

Click to download the PDB-style file with coordinates for d2h2sb_.
(The format of our PDB-style files is described here.)

Timeline for d2h2sb_: