SCOPe 2.04: Domain d2h2pf2: 2h2p F:107-211

Lineage for d2h2pf2 (2h2p F:107-211)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d2h2pf2: 2h2p F:107-211 [136021]
   Other proteins in same PDB: d2h2pa_, d2h2pb_, d2h2pd1, d2h2pf1
   automated match to d1ikfl2
   complexed with sek

Details for d2h2pf2

PDB Entry: 2h2p, 3.1 Å

PDB Description: crystal structure of clc-ec1 in complex with fab fragment in secn-

PDB Compounds: (F:) Fab fragment, light chain

SCOPe Domain Sequences for d2h2pf2:

Sequence; same for both SEQRES and ATOM records:

>d2h2pf2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d2h2pf2:

• d2h2pf2 first appeared in SCOP 1.73
  
• d2h2pf2 appears in SCOPe 2.03
  
• d2h2pf2 appears in SCOPe 2.05
  
• d2h2pf2 appears in the current release, SCOPe 2.08