SCOPe 2.08: Domain d2h2pf1: 2h2p F:1-106

Lineage for d2h2pf1 (2h2p F:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2h2pf1: 2h2p F:1-106 [136020]
   Other proteins in same PDB: d2h2pa_, d2h2pb_, d2h2pc_, d2h2pd2, d2h2pe_, d2h2pf2
   automated match to d1ikfl1
   complexed with sek

Details for d2h2pf1

PDB Entry: 2h2p, 3.1 Å

PDB Description: crystal structure of clc-ec1 in complex with fab fragment in secn-

PDB Compounds: (F:) Fab fragment, light chain

SCOPe Domain Sequences for d2h2pf1:

Sequence; same for both SEQRES and ATOM records:

>d2h2pf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d2h2pf1:

• d2h2pf1 first appeared in SCOP 1.73
  
• d2h2pf1 appears in SCOPe 2.07