SCOP 1.75: Domain d2h2jc2: 2h2j C:50-310

Lineage for d2h2jc2 (2h2j C:50-310)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)

6. Protein RuBisCo LSMT catalytic domain [82211] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)

8. Domain d2h2jc2: 2h2j C:50-310 [136013]
   Other proteins in same PDB: d2h2ja1, d2h2jb1, d2h2jc1
   automatically matched to d1ozvb2
   complexed with mlz, sfg

Details for d2h2jc2

PDB Entry: 2h2j, 2.45 Å

PDB Description: structure of rubisco lsmt bound to sinefungin and monomethyllysine

PDB Compounds: (C:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase

SCOP Domain Sequences for d2h2jc2:

Sequence; same for both SEQRES and ATOM records:

>d2h2jc2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

Timeline for d2h2jc2:

• d2h2jc2 first appeared in SCOP 1.73
  
• d2h2jc2 appears in SCOPe 2.01
  
• d2h2jc2 appears in the current release, SCOPe 2.08