Lineage for d2h2ja2 (2h2j A:50-310)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427940Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2427995Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 2427996Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 2427997Species Pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 2428004Domain d2h2ja2: 2h2j A:50-310 [136009]
    Other proteins in same PDB: d2h2ja1, d2h2ja3, d2h2jb1, d2h2jb3, d2h2jc1, d2h2jc3
    automated match to d1p0ya2
    complexed with mlz, sfg

Details for d2h2ja2

PDB Entry: 2h2j (more details), 2.45 Å

PDB Description: structure of rubisco lsmt bound to sinefungin and monomethyllysine
PDB Compounds: (A:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase

SCOPe Domain Sequences for d2h2ja2:

Sequence, based on SEQRES records: (download)

>d2h2ja2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

Sequence, based on observed residues (ATOM records): (download)

>d2h2ja2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlnl
vvvpmadlinhsagvttedhayeylfslksplsvkageqvyiqydlnksnaelaldygfi
epnenrh

SCOPe Domain Coordinates for d2h2ja2:

Click to download the PDB-style file with coordinates for d2h2ja2.
(The format of our PDB-style files is described here.)

Timeline for d2h2ja2: