SCOPe 2.08: Domain d2h2ia_: 2h2i A:

Lineage for d2h2ia_ (2h2i A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [187125] (7 PDB entries)

8. Domain d2h2ia_: 2h2i A: [136007]
   automated match to d1ma3a_
   complexed with zn, zpg

Details for d2h2ia_

PDB Entry: 2h2i, 1.8 Å

PDB Description: The Structural basis of Sirtuin Substrate Affinity

PDB Compounds: (A:) NAD-dependent deacetylase

SCOPe Domain Sequences for d2h2ia_:

Sequence; same for both SEQRES and ATOM records:

>d2h2ia_ c.31.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
eegg

Timeline for d2h2ia_:

• d2h2ia_ first appeared in SCOP 1.73, called d2h2ia1
  
• d2h2ia_ appears in SCOPe 2.07