Lineage for d2h2ga_ (2h2g A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107620Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2107621Protein automated matches [190312] (11 species)
    not a true protein
  7. 2107702Species Thermotoga maritima [TaxId:2336] [187125] (7 PDB entries)
  8. 2107703Domain d2h2ga_: 2h2g A: [136005]
    automated match to d1ma3a_
    complexed with zn

Details for d2h2ga_

PDB Entry: 2h2g (more details), 1.63 Å

PDB Description: The Structural Basis of Sirtuin substrate affinity
PDB Compounds: (A:) NAD-dependent deacetylase

SCOPe Domain Sequences for d2h2ga_:

Sequence, based on SEQRES records: (download)

>d2h2ga_ c.31.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
eeggi

Sequence, based on observed residues (ATOM records): (download)

>d2h2ga_ c.31.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
mkmkefldllnesrltvtltgagistpsgipdfysqnvfdidffyshpeefyrfakegif
pmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcek
kytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgs
slvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggi

SCOPe Domain Coordinates for d2h2ga_:

Click to download the PDB-style file with coordinates for d2h2ga_.
(The format of our PDB-style files is described here.)

Timeline for d2h2ga_: