![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
![]() | Protein automated matches [190312] (14 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [187125] (7 PDB entries) |
![]() | Domain d2h2fa_: 2h2f A: [136004] automated match to d1ma3a_ complexed with zn |
PDB Entry: 2h2f (more details), 2.2 Å
SCOPe Domain Sequences for d2h2fa_:
Sequence, based on SEQRES records: (download)
>d2h2fa_ c.31.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm eeggis
>d2h2fa_ c.31.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} mkmkefldllnesrltvtltgagistpsgipdqnvfdidffyshpeefyrfakegifpml qakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekkyt vedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgsslv vypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggis
Timeline for d2h2fa_: