Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein) |
Protein RuBisCo LSMT catalytic domain [82211] (1 species) |
Species Pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries) |
Domain d2h2ec2: 2h2e C:50-310 [136003] Other proteins in same PDB: d2h2ea1, d2h2eb1, d2h2ec1 automated match to d1p0ya2 complexed with lys, sa8 |
PDB Entry: 2h2e (more details), 2.6 Å
SCOPe Domain Sequences for d2h2ec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2ec2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]} lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl nksnaelaldygfiepnenrh
Timeline for d2h2ec2:
View in 3D Domains from other chains: (mouse over for more information) d2h2ea1, d2h2ea2, d2h2eb1, d2h2eb2 |