Lineage for d2h2ec2 (2h2e C:50-310)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678656Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 678687Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 678688Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 678689Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 678710Domain d2h2ec2: 2h2e C:50-310 [136003]
    Other proteins in same PDB: d2h2ea1, d2h2eb1, d2h2ec1
    automatically matched to d1ozvb2
    complexed with lys, sa8

Details for d2h2ec2

PDB Entry: 2h2e (more details), 2.6 Å

PDB Description: structure of rubisco lsmt bound to azaadomet and lysine
PDB Compounds: (C:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase

SCOP Domain Sequences for d2h2ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2ec2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

SCOP Domain Coordinates for d2h2ec2:

Click to download the PDB-style file with coordinates for d2h2ec2.
(The format of our PDB-style files is described here.)

Timeline for d2h2ec2: