Lineage for d2h28b1 (2h28 B:16-118)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731869Superfamily d.110.8: YeeU-like [143737] (1 family) (S)
    beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
  5. 731870Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
    Pfam PF06154
  6. 731871Protein Hypothetical protein YeeU [143741] (2 species)
  7. 731872Species Escherichia coli [TaxId:562] [143742] (1 PDB entry)
  8. 731874Domain d2h28b1: 2h28 B:16-118 [135996]
    automatically matched to 2H28 A:16-122
    complexed with cl, gol, mg

Details for d2h28b1

PDB Entry: 2h28 (more details), 2.1 Å

PDB Description: crystal structure of yeeu from e. coli. northeast structural genomics target er304
PDB Compounds: (B:) Hypothetical protein yeeU

SCOP Domain Sequences for d2h28b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h28b1 d.110.8.1 (B:16-118) Hypothetical protein YeeU {Escherichia coli [TaxId: 562]}
drpwwglpctvtpcfgarlvqegnrlhyladragirglfsdadayhldqafpllmkqlel
mltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptp

SCOP Domain Coordinates for d2h28b1:

Click to download the PDB-style file with coordinates for d2h28b1.
(The format of our PDB-style files is described here.)

Timeline for d2h28b1: