![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.8: YeeU-like [143737] (1 family) ![]() beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer automatically mapped to Pfam PF06154 |
![]() | Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins) Pfam PF06154 |
![]() | Protein Hypothetical protein YeeU [143741] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [143742] (1 PDB entry) Uniprot P76364 16-122 |
![]() | Domain d2h28b_: 2h28 B: [135996] Other proteins in same PDB: d2h28a2 automated match to d2inwa1 complexed with cl, gol, mg |
PDB Entry: 2h28 (more details), 2.1 Å
SCOPe Domain Sequences for d2h28b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h28b_ d.110.8.1 (B:) Hypothetical protein YeeU {Escherichia coli [TaxId: 562]} hdrpwwglpctvtpcfgarlvqegnrlhyladragirglfsdadayhldqafpllmkqle lmltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptp
Timeline for d2h28b_: