Lineage for d2h28a1 (2h28 A:16-122)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211311Superfamily d.110.8: YeeU-like [143737] (1 family) (S)
    beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
    automatically mapped to Pfam PF06154
  5. 2211312Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
    Pfam PF06154
  6. 2211313Protein Hypothetical protein YeeU [143741] (2 species)
  7. 2211314Species Escherichia coli [TaxId:562] [143742] (1 PDB entry)
    Uniprot P76364 16-122
  8. 2211315Domain d2h28a1: 2h28 A:16-122 [135995]
    Other proteins in same PDB: d2h28a2
    complexed with cl, gol, mg

Details for d2h28a1

PDB Entry: 2h28 (more details), 2.1 Å

PDB Description: crystal structure of yeeu from e. coli. northeast structural genomics target er304
PDB Compounds: (A:) Hypothetical protein yeeU

SCOPe Domain Sequences for d2h28a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h28a1 d.110.8.1 (A:16-122) Hypothetical protein YeeU {Escherichia coli [TaxId: 562]}
drpwwglpctvtpcfgarlvqegnrlhyladragirglfsdadayhldqafpllmkqlel
mltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptpemkn

SCOPe Domain Coordinates for d2h28a1:

Click to download the PDB-style file with coordinates for d2h28a1.
(The format of our PDB-style files is described here.)

Timeline for d2h28a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h28a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2h28b_